PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g21420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family TALE
Protein Properties Length: 641aa    MW: 71571.9 Da    PI: 5.5089
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g21420genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-094044411954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  CA04g21420 404 FEHflHPYPKDSEKIMLARQTGLTRSQVANWFINARVR 441
                 554459******************************88 PP

2BELL1231.2e-39270341172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 er++l++k +kL s+l+eVd+rYk y++q+q+v+ssFe+vaglg+akpYtslAlk+iSr+FrcL+dai++qi
  CA04g21420 270 ERHDLESKMTKLFSMLDEVDRRYKEYYQQMQVVVSSFEMVAGLGAAKPYTSLALKTISRQFRCLRDAIKKQI 341
                 799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.6E-57194339IPR006563POX domain
PfamPF075261.7E-47200337IPR006563POX domain
PROSITE profilePS5007112.341382445IPR001356Homeobox domain
CDDcd000861.25E-12385446No hitNo description
SMARTSM003894.4E-10385449IPR001356Homeobox domain
SuperFamilySSF466892.35E-17386452IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-28388451IPR009057Homeodomain-like
PfamPF059202.1E-17402441IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 641 aa     Download sequence    Send to blast
MSFLPDEKFV SYQSTDHSDS PVHLNQHSAS VSYSELPTQN YGEVQTMRGK DEMLFIPPTS  60
ESGGMQPIGR AVNAVPNFLE NSVMMDPHSF PIKQLLVPNS EQSLQNQGLS LSLGTQVPLS  120
LHVYSYQDDY TNSGLSSLVG THVLHSEQGS ENKESKVAEY LSFDLAGGTR AANNPQSSMS  180
LRELNSGVRP HVVSGAAAAI YNSKYLKAAQ DLLDEVVNVQ EALKESDKLR NFNLLGQDRS  240
EEADLKSSSS ATGISGDHNN STKAEISPSE RHDLESKMTK LFSMLDEVDR RYKEYYQQMQ  300
VVVSSFEMVA GLGAAKPYTS LALKTISRQF RCLRDAIKKQ IQITRRSLGE QGDSQGERLY  360
RLRYVDQQLR QQRSLQQFGM MRQPWRPQRG LPETAVSVLR AWLFEHFLHP YPKDSEKIML  420
ARQTGLTRSQ VANWFINARV RLWKPMIEDM YKEEFGVAEA GSGASPERRL LVDSKEKSIA  480
ENTGEEIPES FTTPAANCSH LDPSDESSNV VTNVQNNPFA TKFSFQDGAF EHERIDCGSS  540
KLQSEQIPIT HGFGLKPSSD GNIIGALNTY HPSMLGDIMG NQVSLALRLQ NSQMDQQPQL  600
REDEKTDSTV DIGKGEYYYI DPVNQQERFS GPHLLSDFVV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B8e-17391448158Homeobox protein Meis1
4xrs_A8e-17391448158Homeobox protein Meis1
3k2a_B1e-16391448562Homeobox protein Meis2
3k2a_A1e-16391448562Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016568507.10.0PREDICTED: BEL1-like homeodomain protein 3
TrEMBLM0ZWL90.0M0ZWL9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000096100.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-102BEL1-like homeodomain 7